Total number of results for RFamide neuropeptide are 5
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05221 |
QDDGSEATGLLLGEAEKVGGLLGTLAEELNGYSRKKGGFSFRF
|
43 | Bos taurus | RFamide neuropeptide | QRF-amide | ||
| NP05222 |
QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRF
|
43 | Homo sapiens | RFamide neuropeptide | QRF-amide | ||
| NP05223 |
QDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRF
|
43 | Mus musculus | RFamide neuropeptide | QRF-amide | ||
| NP05224 |
VGTALGSLAEELNGYNRKKGGFSFRF
|
26 | Rana esculenta | RFamide neuropeptide | Orexigenic neuropeptide 26RFa | 14657341#Chartrel N., Dujardin C., Anouar Y., Leprince J., Decker A., Clerens S., Do-Rego J.-C., Vandesande F., Llorens-Cortes C., Costentin J., Beauvillain J.-C., Vaudry H.; #Identification of 26RFa, a hypothalamic neuropeptide of the RFamide peptide family with orexigenic activity.; #Proc. Natl. Acad. Sci. U.S.A. 100:15247-15252(2003). | |
| NP05225 |
QDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRF
|
43 | Rattus norvegicus | RFamide neuropeptide | QRF-amide | 16648250#Takayasu S., Sakurai T., Iwasaki S., Teranishi H., Yamanaka A., Williams S.C., Iguchi H., Kawasawa Y.I., Ikeda Y., Sakakibara I., Ohno K., Ioka R.X., Murakami S., Dohmae N., Xie J., Suda T., Motoike T., Ohuchi T., Yanagisawa M., Sakai J.; #A neuropeptide ligand of the G protein-coupled receptor GPR103 regulates feeding, behavioral arousal, and blood pressure in mice.; #Proc. Natl. Acad. Sci. U.S.A. 103:7438-7443(2006). |